| Products/Services Used | Details | Operation |
|---|---|---|
| Peptide Synthesis> | The LL37 antimicrobial peptide ([LL-37, 37 aa]) was synthesized with the help of GenScript Biotech Corporation (Nanjing, China) with purities greater than or equal to 98%. | Get A Quote |
The harsh microenvironment of the urethral injury often carries high risks of early undesirable healing as well as late scar tissue formation. Indeed, the infection and inflammatory response in the early stages as well as blood vessel formation and tissue regeneration in the later stages fundamentally impact the outcomes of urethral wound healing. Innovatively, an integrated whole-process repair hydrogel (APF/C/L@dECM) is designed. After rigorous testing, it is found that hydrogels formed by hydrophobic association and double cross-linking of amide bonds can procedurally regulate wound healing in all phases to match the repair process. In rabbit models of urethral wound, APF/C/L@dECM hydrogel can achieve scarle... More