| Products/Services Used | Details | Operation |
|---|---|---|
| Codon Optimization> | … designed; one was codon optimized for expression in E. coli; and the second for expression in mammalian cells and both were synthesized by GenScript USA, Inc (Piscataway, NJ) … (WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDK) were also synthesized26 (GenScript) … | Get A Quote |
The V1V2 loop of the Env protein is a major target for HIV-1 vaccine development because in multiple studies antibodies to this region correlated with protection. Although SAPNs expressed in E. coli elicited anti-V1V2 antibodies, the Env protein is heavily glycosylated. In this study the technology has been adapted for expression in mammalian cells. SAPNs containing a V1V2 loop from a B-subtype transmitter/founder virus were expressed in E. coli, ExpiCHO, and Expi293 cells. Independent of the expression host, particles were well-formed. All SAPNs raised high titers of V1V2-specific antibodies, however, SAPN induced a mainly anti-V1 response, while SAPN and SAPN induced a predominantly anti-V2 response. In an AD... More